Protein Info for HMPREF1058_RS12685 in Phocaeicola vulgatus CL09T03C04

Annotation: acetyl-CoA carboxylase biotin carboxyl carrier protein subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF00364: Biotin_lipoyl" amino acids 99 to 165 (67 residues), 52.5 bits, see alignment E=5.2e-18

Best Hits

KEGG orthology group: None (inferred from 99% identity to bvu:BVU_1464)

Predicted SEED Role

"Biotin carboxyl carrier protein of acetyl-CoA carboxylase; Biotin carboxyl carrier protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I8ZZJ2 at UniProt or InterPro

Protein Sequence (171 amino acids)

>HMPREF1058_RS12685 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit (Phocaeicola vulgatus CL09T03C04)
MEIHIGDRVADVTLVSKEGNKVQFMIDGKPYDVDIVMAENGSCSILHDGNSFNAELIRGE
GGKSYDVNMFYRSYHVDIVDTQTKYLRMKKGGEERQDDKIVAPMPGKVVKIPVRKGDRLS
SGDIVVVLEAMKMQSNYKVTSDCTVRDILVNEGDSVNANQVLIVLDIIKED