Protein Info for HMPREF1058_RS12665 in Phocaeicola vulgatus CL09T03C04

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 PF13420: Acetyltransf_4" amino acids 23 to 134 (112 residues), 28.3 bits, see alignment E=5.9e-10 PF13673: Acetyltransf_10" amino acids 35 to 138 (104 residues), 52.7 bits, see alignment E=1.5e-17 PF13527: Acetyltransf_9" amino acids 36 to 131 (96 residues), 36.7 bits, see alignment E=1.4e-12 PF00583: Acetyltransf_1" amino acids 37 to 130 (94 residues), 69 bits, see alignment E=1.5e-22 PF13508: Acetyltransf_7" amino acids 47 to 132 (86 residues), 55.3 bits, see alignment E=2.6e-18 PF14542: Acetyltransf_CG" amino acids 66 to 110 (45 residues), 30.2 bits, see alignment E=1.5e-10 PF08445: FR47" amino acids 75 to 137 (63 residues), 29.9 bits, see alignment E=1.5e-10

Best Hits

KEGG orthology group: None (inferred from 99% identity to bvu:BVU_1460)

Predicted SEED Role

"Streptothricin acetyltransferase, Streptomyces lavendulae type" in subsystem Streptothricin resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9UDK1 at UniProt or InterPro

Protein Sequence (143 amino acids)

>HMPREF1058_RS12665 GNAT family N-acetyltransferase (Phocaeicola vulgatus CL09T03C04)
MTEIVEVKDFIPAYTDAVQKLLEQLTNRPVKLTGTTLRKIISQENTHLFFLLADQEIAGM
LTVGIYHSPTGGKAWIEDVVVDEKYRGQGLSKQLVTHAVRFVKEQGIPLIMLTSNPTRIA
ANKLYQKLGFEQKQTNVYRMNLE