Protein Info for HMPREF1058_RS12605 in Phocaeicola vulgatus CL09T03C04

Annotation: HAD family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 PF00702: Hydrolase" amino acids 3 to 174 (172 residues), 84.6 bits, see alignment E=3.1e-27 PF12710: HAD" amino acids 6 to 170 (165 residues), 35.6 bits, see alignment E=3.3e-12 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 6 to 174 (169 residues), 41.2 bits, see alignment E=2.2e-14 PF13419: HAD_2" amino acids 6 to 179 (174 residues), 148.1 bits, see alignment E=8e-47 PF13242: Hydrolase_like" amino acids 136 to 181 (46 residues), 28.9 bits, see alignment 2.2e-10

Best Hits

KEGG orthology group: None (inferred from 53% identity to ere:EUBREC_3622)

Predicted SEED Role

"Haloacid dehalogenase-like hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I8ZYG0 at UniProt or InterPro

Protein Sequence (206 amino acids)

>HMPREF1058_RS12605 HAD family hydrolase (Phocaeicola vulgatus CL09T03C04)
MKYKHIVFDIDGTLIDTEYAVINSLIKTITEITGRTPQYESLKFALGITGRNALELLKIP
DIEDALKRWDRNMKLLQHTIQPFQGIKECLQSLLSRGYILGIVTSKTYQEYYSDFEPLGL
ADYFSTIVCADDTDEHKPQAAPLVAYLAKAHVSPENALYIGDSIYDIQCANNAGVDSGLV
LWSNNVSNPIRADYYFKTPNDISKIL