Protein Info for HMPREF1058_RS12555 in Phocaeicola vulgatus CL09T03C04

Annotation: polyribonucleotide nucleotidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 711 TIGR03591: polyribonucleotide nucleotidyltransferase" amino acids 13 to 700 (688 residues), 955.5 bits, see alignment E=9e-292 PF01138: RNase_PH" amino acids 14 to 145 (132 residues), 102.5 bits, see alignment E=6e-33 amino acids 327 to 457 (131 residues), 89.6 bits, see alignment E=5.8e-29 PF03725: RNase_PH_C" amino acids 148 to 212 (65 residues), 55 bits, see alignment E=1.6e-18 amino acids 462 to 533 (72 residues), 24.5 bits, see alignment E=5.4e-09 PF03726: PNPase" amino acids 244 to 324 (81 residues), 44.8 bits, see alignment E=3.5e-15 PF00013: KH_1" amino acids 560 to 620 (61 residues), 47.6 bits, see alignment 2.8e-16 PF00575: S1" amino acids 626 to 699 (74 residues), 57.5 bits, see alignment E=3.7e-19

Best Hits

Swiss-Prot: 100% identical to PNP_BACV8: Polyribonucleotide nucleotidyltransferase (pnp) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K00962, polyribonucleotide nucleotidyltransferase [EC: 2.7.7.8] (inferred from 100% identity to bvu:BVU_1431)

Predicted SEED Role

"Polyribonucleotide nucleotidyltransferase (EC 2.7.7.8)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Polyadenylation bacterial (EC 2.7.7.8)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9J1J8 at UniProt or InterPro

Protein Sequence (711 amino acids)

>HMPREF1058_RS12555 polyribonucleotide nucleotidyltransferase (Phocaeicola vulgatus CL09T03C04)
MINPIVKTIELPDGRTITLETGKLAKQADGSVMLRMGNTMLLATVCAAKDAVPGTDFMPL
QVEYKEKYSAFGRFPGGFTKREGKASDYEILTCRLVDRALRPLFPDNFHAEVYVNIVLFS
ADGIDMPDALAGLAASAALAVSDIPFGGPISEVRVARIDGQFVINPTFEQLEKADMDLMV
AATYDNIMMVEGEMQEVSEQDLLAAMKAAHEAIKVHCKAQMELMEEVGSTVKREYCHEEN
DEDLRKAVREACYDKAYAIAASGNRNKHERQDAFDAIRDEFKTQYTEEELEEKGALIDRY
YHDVEKEAMRRCILDEGKRLDGRKTTEIRPIWCEVGYLPGPHGSAIFTRGETQSLTSVTL
GTKLDEKIVDDVLDQHRERFLLHYNFPPYSTGEAKAQRGVGRREIGHGHLAWRALKGQIP
AGYPYTVRVVSDIMESNGSSSMATVCAGTLALMDAGVAMKKPVSGIAMGLIKNAGEEKYA
VLSDILGDEDHLGDMDFKVTGTRDGITATQMDIKVDGLSFEILEKALLQAKEGREHILNK
LTECIAEPRKDLKPHAPRIETMTIPKEFIGAIIGPGGKIIQGMQEETGATITIEETDGVG
RIEIAGTNKKCIDDAMRIIKGIVAVPEVGEVYVGKVRSVMPYGVFVEFLPGKDGLLHISE
IDWKRLETIEEAGLKEGDEIEVKLLDIDPKTGKFKLSHKVLLPRPEKQEKK