Protein Info for HMPREF1058_RS12510 in Phocaeicola vulgatus CL09T03C04

Annotation: glycyl-radical enzyme activating protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02494: glycyl-radical enzyme activating protein
  • amino acids 4 to 291 (288 residues), 310.4 bits, E=5.9e-97
• PF13353: Fer4_12
  • amino acids 14 to 51 (38 residues), 24.4 bits, 1.5e-08
• PF00037: Fer4
  • amino acids 51 to 69 (19 residues), 26.7 bits, see alignment (E = 1.6e-09)
  • amino acids 76 to 98 (23 residues), 26.9 bits, see alignment (E = 1.4e-09)
• PF13187: Fer4_9
  • amino acids 52 to 97 (46 residues), 31.6 bits, 6.2e-11
• PF12838: Fer4_7
  • amino acids 52 to 94 (43 residues), 36.3 bits, 3e-12
• PF12837: Fer4_6
  • amino acids 78 to 97 (20 residues), 24.1 bits, see alignment (E = 1.2e-08)
• PF04055: Radical_SAM
  • amino acids 100 to 229 (130 residues), 43.6 bits, E=1.7e-14

Best Hits

Swiss-Prot: 40% identical to HYPDA_CLODI: Trans-4-hydroxy-L-proline dehydratase activating enzyme (pflE) from Clostridioides difficile

KEGG orthology group: K04069, pyruvate formate lyase activating enzyme [EC: 1.97.1.4] (inferred from 99% identity to bvu:BVU_1420)

Predicted SEED Role

"Pyruvate formate-lyase activating enzyme (EC 1.97.1.4)" in subsystem Fermentations: Mixed acid or Threonine anaerobic catabolism gene cluster (EC 1.97.1.4)

MetaCyc Pathways

• superpathway of N-acetylneuraminate degradation (17/22 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (10/13 steps found)
• reductive monocarboxylic acid cycle (2/2 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
• mixed acid fermentation (12/16 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• pyruvate fermentation to ethanol I (2/3 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.4

Use Curated BLAST to search for 1.97.1.4

Sequence Analysis Tools

See I9UDJ9 at UniProt or InterPro

Protein Sequence (302 amino acids)

>HMPREF1058_RS12510 glycyl-radical enzyme activating protein (Phocaeicola vulgatus CL09T03C04)
MSLIFDIKRYAINDGPGIRITLFMKGCPLSCIWCHNPEGIRNGKDKLYTAKKCLGCGTCL
KVCPNGALTLAPEGIITDKQKCVLCGRCAEECPAMAIEISGTEYTAEYLMHEIEKEIPFM
DQSGGGVTFCGGEPLLHPEFLIDILKRCGQQGIHRAVDTTLLARKETVDEVMRNCELLLI
DLKSMDSTVHQTFCDVPNELILENIRRVAEADFPYYIRIPLIEGVNADEKNIKLSAEFLA
SLPRHPEIINLLPYHDIGKGKHAKLGSIYNPKGYKMQTPSEEVQQQCIQILTDYGLKATI
GG