Protein Info for HMPREF1058_RS12495 in Phocaeicola vulgatus CL09T03C04

Annotation: glycine cleavage system protein GcvH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00527: glycine cleavage system H protein
  • amino acids 3 to 125 (123 residues), 162.9 bits, E=1.8e-52
• PF01597: GCV_H
  • amino acids 8 to 125 (118 residues), 154.3 bits, E=6.9e-50

Best Hits

Swiss-Prot: 100% identical to GCSH_BACV8: Glycine cleavage system H protein (gcvH) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 100% identity to bvu:BVU_1417)

MetaCyc: 50% identical to glycine cleavage system H protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)

Sequence Analysis Tools

See I8ZYL0 at UniProt or InterPro

Protein Sequence (126 amino acids)

>HMPREF1058_RS12495 glycine cleavage system protein GcvH (Phocaeicola vulgatus CL09T03C04)
MEFPSNVKYTKEHEWIRVEGDIAYVGITDYAQEQLGDIVFVDITTEGETLEKDEVFGTIE
VVKTISDLFLPVSGEVLEQNEALADNPELVNQDPYGKGWLIKIKPNDSNDVNDLLDAEGY
KALVNE