Protein Info for HMPREF1058_RS12435 in Phocaeicola vulgatus CL09T03C04

Annotation: division/cell wall cluster transcriptional repressor MraZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF02381: MraZ" amino acids 3 to 61 (59 residues), 36.9 bits, see alignment E=1.5e-13 amino acids 86 to 125 (40 residues), 32.7 bits, see alignment E=3.1e-12

Best Hits

Swiss-Prot: 100% identical to MRAZ_BACV8: Transcriptional regulator MraZ (mraZ) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K03925, MraZ protein (inferred from 100% identity to bvu:BVU_1405)

Predicted SEED Role

"Cell division protein MraZ" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9UCQ2 at UniProt or InterPro

Protein Sequence (154 amino acids)

>HMPREF1058_RS12435 division/cell wall cluster transcriptional repressor MraZ (Phocaeicola vulgatus CL09T03C04)
MRFLGNSEAKTDAKGRVFLPAVFRKQLQAASQECLILRKDTYQDCLVLYPENVWNEQMNE
LRCKLNRWNSRHQMIFRQFVSDVEVITLDGNGRFLIPKRYLKLAKIQQDVRFIGLDDTIE
IWSKEIADKPFITPEDFGKELEEIMGTNNNVEIE