Protein Info for HMPREF1058_RS12430 in Phocaeicola vulgatus CL09T03C04
Annotation: 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RSMH_BACV8: Ribosomal RNA small subunit methyltransferase H (rsmH) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)
KEGG orthology group: K03438, S-adenosyl-methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to bvu:BVU_1404)Predicted SEED Role
"rRNA small subunit methyltransferase H" in subsystem Bacterial Cell Division
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Anthocyanin biosynthesis
- Benzoxazinone biosynthesis
- Biosynthesis of alkaloids derived from shikimate pathway
- Carotenoid biosynthesis - General
- Flavonoid biosynthesis
- Histidine metabolism
- Insect hormone biosynthesis
- Naphthalene and anthracene degradation
- Phenylpropanoid biosynthesis
- Porphyrin and chlorophyll metabolism
- Tryptophan metabolism
- Tyrosine metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.1.1.-
Use Curated BLAST to search for 2.1.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See I8ZYM3 at UniProt or InterPro
Protein Sequence (304 amino acids)
>HMPREF1058_RS12430 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH (Phocaeicola vulgatus CL09T03C04) MSEAKQIYHVPVLLNESVDGMNIQPGGIYVDATFGGGGHSKEILSRLDSTAHLYSFDQDE DAEKNIVSDSRFTFVRSNFRYLPNFLRYYGVEGVDAILADLGVSSHHFDDSERGFSFRFE GKLDMRMNKRAGMTAADVVNTYDEERLANIFYLYGELKNSRKLASAIVKARGVKQIVTIG DFLEVIKPLFGREREKKELAKVFQALRIEVNQEMEALKEMLYAATKALKPGGRLVVITYH SLEDRMVKNIMKTGNIEGKAEQDFFGNVQTPFKLVNNKVIVAGNEEVTRNPRSRSAKLRI AEKR