Protein Info for HMPREF1058_RS11370 in Phocaeicola vulgatus CL09T03C04

Annotation: methionine adenosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00438: S-AdoMet_synt_N
  • amino acids 3 to 100 (98 residues), 145.4 bits, E=9.7e-47
• TIGR01034: methionine adenosyltransferase
  • amino acids 4 to 392 (389 residues), 504.1 bits, E=1.1e-155
• PF02772: S-AdoMet_synt_M
  • amino acids 113 to 255 (143 residues), 145.6 bits, E=1.1e-46
• PF02773: S-AdoMet_synt_C
  • amino acids 257 to 390 (134 residues), 207.9 bits, E=8.4e-66

Best Hits

Swiss-Prot: 100% identical to METK_BACV8: S-adenosylmethionine synthase (metK) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K00789, S-adenosylmethionine synthetase [EC: 2.5.1.6] (inferred from 100% identity to bvu:BVU_1184)

Predicted SEED Role

"S-adenosylmethionine synthetase (EC 2.5.1.6)" in subsystem Methionine Biosynthesis or Methionine Degradation or Quorum Sensing: Autoinducer-2 Synthesis (EC 2.5.1.6)

MetaCyc Pathways

• aspartate superpathway (19/25 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• S-adenosyl-L-methionine biosynthesis (1/1 steps found)
• S-adenosyl-L-methionine salvage I (3/4 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
• S-adenosyl-L-methionine salvage II (1/3 steps found)
• L-methionine degradation I (to L-homocysteine) (1/3 steps found)
• ethene biosynthesis I (plants) (1/3 steps found)
• 2'-deoxymugineic acid phytosiderophore biosynthesis (1/4 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (1/5 steps found)
• superpathway of L-methionine salvage and degradation (7/16 steps found)
• L-methionine salvage cycle II (plants) (3/11 steps found)
• L-methionine salvage cycle I (bacteria and plants) (3/12 steps found)
• L-methionine salvage cycle III (2/11 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.6

Sequence Analysis Tools

See I9UC10 at UniProt or InterPro

Protein Sequence (430 amino acids)

>HMPREF1058_RS11370 methionine adenosyltransferase (Phocaeicola vulgatus CL09T03C04)
MGYLFTSESVSEGHPDKVADQISDAVLDKLLAFDPSSKVACETLVTTGQVVLAGEVKTKA
YVDLQRIAREVINRIGYTKSEYMFEGNSCGVFSAIHEQSADINRGVEREDPMNQGAGDQG
MMFGYATNETENYMPLSLDLAHKLLMVLAEIRREGKVMTYLRPDAKSQVTIEYDDNGKPV
RIDTIVVSTQHDEFVTPADSSKEAQLKADEEMLAKIRQDVIEILMPRVIAGIHNEEVLAL
FNDRIVYHVNPTGKFVIGGPHGDTGLTGRKIIVDTYGGKGAHGGGAFSGKDPSKVDRSAA
YAARHIAKNMVAAGVADEMLVQVSYAIGVARPINIYVNTYGRSNVKLSDGEIAKKIDELF
DLRPKAIEERLKLRNPIYEETASYGHMGREPKVVIKTYESMYHEAKTLEVELFTWEKLDY
VDKIKEAFGL