Protein Info for HMPREF1058_RS11325 in Phocaeicola vulgatus CL09T03C04

Annotation: 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01498: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
  • amino acids 3 to 133 (131 residues), 126.3 bits, E=4.1e-41
• PF01288: HPPK
  • amino acids 4 to 133 (130 residues), 125 bits, E=1.1e-40

Best Hits

Swiss-Prot: 54% identical to HPPK_PORG3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (folK) from Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)

KEGG orthology group: K00950, 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC: 2.7.6.3] (inferred from 100% identity to bvu:BVU_1174)

Predicted SEED Role

"2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3)" in subsystem Folate Biosynthesis (EC 2.7.6.3)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis IV (Plasmodium) (2/3 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (3/5 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis III (Chlamydia) (3/5 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis V (Pyrococcus) (1/4 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis II (Methanocaldococcus) (2/7 steps found)
• superpathway of chorismate metabolism (38/59 steps found)
• tetrahydromethanopterin biosynthesis (2/14 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.7.6.3

Use Curated BLAST to search for 2.7.6.3

Sequence Analysis Tools

See I8ZWZ7 at UniProt or InterPro

Protein Sequence (148 amino acids)

>HMPREF1058_RS11325 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase (Phocaeicola vulgatus CL09T03C04)
MRVYLGLGTNLGDKESNLHVAVRKINERIGEVTALSAFYVTAPWGFSSENSFLNAACCVE
SVLPPLDILRETQEIERELGRMKKSAGGNYSDRLIDIDILLYGDLILHTPELEIPHPLMT
ERRFVMDPLAEIASDVVHPVLGKRLGEL