Protein Info for HMPREF1058_RS11235 in Phocaeicola vulgatus CL09T03C04

Annotation: non-canonical purine NTP diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00042: non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
  • amino acids 4 to 191 (188 residues), 197.7 bits, E=5.9e-63
• PF01725: Ham1p_like
  • amino acids 5 to 189 (185 residues), 241.9 bits, E=2.4e-76

Best Hits

Swiss-Prot: 81% identical to IXTPA_BACTN: dITP/XTP pyrophosphatase (BT_3128) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01516, nucleoside-triphosphatase [EC: 3.6.1.15] (inferred from 100% identity to bvu:BVU_1146)

Predicted SEED Role

"Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.15)" in subsystem Heat shock dnaK gene cluster extended (EC 3.6.1.15)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (16/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (8/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (7/9 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (5/7 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (10/14 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.15

Sequence Analysis Tools

See I9UB75 at UniProt or InterPro

Protein Sequence (193 amino acids)

>HMPREF1058_RS11235 non-canonical purine NTP diphosphatase (Phocaeicola vulgatus CL09T03C04)
MKKKLVFATNNAHKLDEISSILGEKVELLSLKDIHCHVDIPETADTLEGNAMLKAEYIYK
NYGLDCFADDTGLEVEALNGAPGVYSARYAGGEGHNAEANMQKLLQNMQGVQNRKAQFRT
AICLILDGKKHLFEGIVKGEIIKEKRGSSGFGYDPIFVPEGYTKTFAELGNETKNKISHR
ALAVEKLCRFLKA