Protein Info for HMPREF1058_RS10765 in Phocaeicola vulgatus CL09T03C04

Annotation: ribonuclease III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 TIGR02191: ribonuclease III" amino acids 24 to 239 (216 residues), 193.9 bits, see alignment E=1.4e-61 PF14622: Ribonucleas_3_3" amino acids 33 to 159 (127 residues), 115.1 bits, see alignment E=3.7e-37 PF00636: Ribonuclease_3" amino acids 59 to 145 (87 residues), 77 bits, see alignment E=2.6e-25 PF00035: dsrm" amino acids 175 to 237 (63 residues), 41 bits, see alignment E=3.4e-14

Best Hits

Swiss-Prot: 100% identical to RNC_BACV8: Ribonuclease 3 (rnc) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K03685, ribonuclease III [EC: 3.1.26.3] (inferred from 100% identity to bvu:BVU_1049)

Predicted SEED Role

"Ribonuclease III (EC 3.1.26.3)" in subsystem RNA processing and degradation, bacterial or Two cell division clusters relating to chromosome partitioning (EC 3.1.26.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9UCE4 at UniProt or InterPro

Protein Sequence (308 amino acids)

>HMPREF1058_RS10765 ribonuclease III (Phocaeicola vulgatus CL09T03C04)
MFSNIKDRIRLLFRKDRESYLRFYKMLGFYPKDISIYEQALLHKSLSVKSEKGRLLNNER
LEFLGDAILDAVVADIVYKRFEGKREGFLTNTRSKIVQRETLNRLAIEIGLDKLIKYTAR
QSSHNSYMCGNAFEALVGAIYLDRGYRACKYFMEHRIIGPYINLEKISRKEVNFKSKLIE
WSQKNRFEVTFELITQSHDQGYNPTFESEVLVEGISGGKGTGYSKKESQQMAARVALGKI
KNDSGFIECIFAAKTARELPQEEVTVSDSKPSDSGAVTPDLSLEEIKKTDVVEQIISEAE
EKAFKENA