Protein Info for HMPREF1058_RS09720 in Phocaeicola vulgatus CL09T03C04

Annotation: aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 601 PF12804: NTP_transf_3" amino acids 3 to 131 (129 residues), 44.6 bits, see alignment E=2.7e-15 PF00483: NTP_transferase" amino acids 3 to 119 (117 residues), 41 bits, see alignment E=2.6e-14 PF00155: Aminotran_1_2" amino acids 314 to 596 (283 residues), 107 bits, see alignment E=1.8e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to bvu:BVU_0886)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9U975 at UniProt or InterPro

Protein Sequence (601 amino acids)

>HMPREF1058_RS09720 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme (Phocaeicola vulgatus CL09T03C04)
MQAIILAAGMGKRLGDLTKDNTKCMIKVNGTYLIDRLLSQLDSLNLERIILVIGYQGEKL
RTHIEKQSRNTPIEYIYNPVYNKTNNIYSLYLAKEELQKQDTLLIESDLIFEDTLFHKIL
NNPYPNLALVAKYEPWMDGTMVRLNTENDIIDFISKKTFRYADIDDYYKTVNIYKFSKEF
LRNSYVPFLEAYSKALGNNEYYEQVLRVITLLERCELKGLPLEGERWYEIDDIQDLDIAE
TIFAEQDQLQRYQKRYGGYWRFPKLKDFCYLVNPYFPPQKMCEELQANFNVLLREYPSGM
GVNTLVMAKNFGIRQDYVVVGNGAAEIIKALMEHSDGKMGVIYPTFEEYPNRQSEEIIAF
YPQNADFHYTAKELMLFYADKDIRHLLLINPDNPSGNFIPLNELMDLLAWTQQRNIHLIL
DESFVDFSEKSIENTLLKNEVLETYPHLTVIKSISKSYGVPGLRLGIAASSDKEIISYLR
KNMAIWNINSFAEFYLQIYSKYNNDYQNACKKFIAERQRFFEVLQQVDFLRVIPSQANYF
LCEVTSRFSSTKLVSLLLEHNLLLKDCSTKTGFDGRNYIRIAIRDTEDNNYLAENLKKLQ
A