Protein Info for HMPREF1058_RS09650 in Phocaeicola vulgatus CL09T03C04

Annotation: pyridoxamine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08543: Phos_pyr_kin
  • amino acids 74 to 260 (187 residues), 80.8 bits, E=1.1e-26
• PF00294: PfkB
  • amino acids 124 to 248 (125 residues), 32.3 bits, E=7.2e-12

Best Hits

KEGG orthology group: K00868, pyridoxine kinase [EC: 2.7.1.35] (inferred from 99% identity to bvu:BVU_0872)

Predicted SEED Role

"Pyridoxal kinase (EC 2.7.1.35)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.7.1.35)

MetaCyc Pathways

• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (9/12 steps found)
• pyridoxal 5'-phosphate salvage I (3/6 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (3/8 steps found)
• pyridoxal 5'-phosphate salvage II (plants) (3/9 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.35

Sequence Analysis Tools

See I9U989 at UniProt or InterPro

Protein Sequence (290 amino acids)

>HMPREF1058_RS09650 pyridoxamine kinase (Phocaeicola vulgatus CL09T03C04)
MYTNKVKKIAAVHDLSGAGRVSLTVVIPILSSMGFQVCPLPTAVLSSHTQYPHFSFLDLT
DEMPRIISEWKQLGVQFDAIYTGYLGSPRQIQIVSGFIDDFRQSDSLVMIDPVLGDNGKL
YTNFDERMILEMRHLIRKADVITPNMTELFYLLDKPYKAENTDEELKAYLHEISEHGPGI
VIITSVPVQGDPRKTSVYAYDRQGNRYWKVTCPYLPAHYPGTGDTFTSVITGSLMQGDSL
PIALDRATQFILQGIRATFGYEYDNREGILLEKVLHNLDMPIQVSSYELI