Protein Info for HMPREF1058_RS09250 in Phocaeicola vulgatus CL09T03C04
Annotation: 50S ribosomal protein L15
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RL15_BACV8: 50S ribosomal protein L15 (rplO) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)
KEGG orthology group: K02876, large subunit ribosomal protein L15 (inferred from 100% identity to bvu:BVU_0786)Predicted SEED Role
"LSU ribosomal protein L15p (L27Ae)" in subsystem Ribosome LSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See I9IXR1 at UniProt or InterPro
Protein Sequence (148 amino acids)
>HMPREF1058_RS09250 50S ribosomal protein L15 (Phocaeicola vulgatus CL09T03C04) MNLSNLKPAEGSTKTRKRIGRGPGSGLGGTSTRGHKGAKSRSGYSKKIGFEGGQMPLQRR VPKFGFKNINRVEYKAINLETIQKLAEAKNLTKVGMNDFIEAGFISSNQLVKVLGNGSLT TKLDVEANAFSKSAVAAIEAVGGNAVKL