Protein Info for HMPREF1058_RS09125 in Phocaeicola vulgatus CL09T03C04

Annotation: DUF418 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 93 to 110 (18 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 207 to 230 (24 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 322 to 343 (22 residues), see Phobius details amino acids 349 to 371 (23 residues), see Phobius details PF04235: DUF418" amino acids 229 to 389 (161 residues), 153.1 bits, see alignment E=3.5e-49

Best Hits

KEGG orthology group: K07148, uncharacterized protein (inferred from 100% identity to bvu:BVU_0757)

Predicted SEED Role

"conserved hypothetical protein, putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I8ZT13 at UniProt or InterPro

Protein Sequence (393 amino acids)

>HMPREF1058_RS09125 DUF418 domain-containing protein (Phocaeicola vulgatus CL09T03C04)
MEKQLSEKLPRVEVVDALRGFAVMAILLVHSLEHFIFPVYPVDQPAWLNILNDGVFNVTF
TLLAGKSYAIFALLFGFTFYIQSANQQRKGKDFGYRFLWRLLLLVAFATLNAAFFPAGDV
LLLFSVVGIVLFVVRKWSDCAILVTAILFLLQPVEWYHYIVGLFDPSHTLPDWGVGAMYK
EVAEYTKEGNLWEFLGKNMTFGQKASLYWALGAGRFWQTAGLFLMGLYIGRKQLFVTSEK
HTRFWVKALIISAISFAPLFQLKELIMASDSELIRQTAGTAFDMWQKFAFTFVLVASFVL
LYQRDRFKNFVSNLRYYGRMSLTNYITQSIAGAIIYFPFGLYLAPYCGYTLSLLVGFVLF
LLQVQFCKWWLKGHKQGPLESLWHKWTWMYSKK