Protein Info for HMPREF1058_RS09040 in Phocaeicola vulgatus CL09T03C04

Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 742 PF02861: Clp_N" amino acids 16 to 65 (50 residues), 37.1 bits, see alignment 1.8e-12 PF00004: AAA" amino acids 205 to 318 (114 residues), 51.8 bits, see alignment E=7.8e-17 amino acids 485 to 601 (117 residues), 45 bits, see alignment E=1e-14 PF17871: AAA_lid_9" amino acids 345 to 415 (71 residues), 83.5 bits, see alignment E=6.1e-27 PF00158: Sigma54_activat" amino acids 461 to 591 (131 residues), 20.8 bits, see alignment E=1.7e-07 PF07724: AAA_2" amino acids 480 to 640 (161 residues), 186.6 bits, see alignment E=2.4e-58 PF07728: AAA_5" amino acids 485 to 602 (118 residues), 50.7 bits, see alignment E=1.2e-16 PF10431: ClpB_D2-small" amino acids 656 to 728 (73 residues), 64.2 bits, see alignment E=5.8e-21

Best Hits

KEGG orthology group: K03694, ATP-dependent Clp protease ATP-binding subunit ClpA (inferred from 100% identity to bvu:BVU_0634)

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpA" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I8ZT30 at UniProt or InterPro

Protein Sequence (742 amino acids)

>HMPREF1058_RS09040 AAA family ATPase (Phocaeicola vulgatus CL09T03C04)
MDIPNTDSVNYAFASAQSQAMQYRHEFITPEHLLSALLEQVPFQKALAECFCTPEELSQS
ISEYLSKKVERVPQEIEYELEISGQLSELLQYAYMTISHSSAEEMDVPHLVQGMLQLEDS
WAGYLLKETVGEDMPEFLSSLISNYEHMNQFQEETSSEQEKSEPWRNYVTCLNEGLQDRN
PLIGRNVELERTIQVLCRKEKNNPLHVGEPGVGKTALVYGLAARIEAGNVPERLTGCRIY
ELDLGNLLAGTQYRGEFEKRLKAIMEGIRKEGHAIVYIDEIHNLIGAGRTGDGSMDASNM
LKPYLEGGEIRFIGSTTYEEFNRYFSRSRGLVRRFQQIDIQEPGIEETIHIVEGLKERYE
TFHGVVYEEGVIAYAVTAAARYISDRFLPDKAIDLVDEAGAYREIHPTDTETQTVDKALI
TDILARICKVDVLAMKEEDNATLETLYERISAKIYGQEEAVCQVVEAVQMAKAGLLDENK
PLASLLFVGPTGVGKTEVAKVLASELGIALQRFDMSEYTEKHTVAKLIGSPAGYIGYEDG
GLLTDAIRKTPNCVLLLDEIEKAHPDIFNILLQVMDYAVLTDNKGRKADCRHVILIMTSN
AGAQFAHQASIGFSGQITAGEAMLKQVKKTFKPEFINRLSATVVFHDMDYGMASLILNKK
LNELKNKLSARHVGMELSPEAYKHLLKLGFTKEYGAREMDRVITSQLKPLLMREILFGTL
KTGGKVRVTAGNGELSLQVLKE