Protein Info for HMPREF1058_RS08540 in Phocaeicola vulgatus CL09T03C04

Annotation: anaerobic sulfatase-maturation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 TIGR03942: anaerobic sulfatase maturase" amino acids 15 to 390 (376 residues), 477.5 bits, see alignment E=2.7e-147 PF04055: Radical_SAM" amino acids 21 to 189 (169 residues), 76.8 bits, see alignment E=2.3e-25 TIGR04085: radical SAM additional 4Fe4S-binding SPASM domain" amino acids 282 to 371 (90 residues), 63.2 bits, see alignment E=2.5e-21 PF13186: SPASM" amino acids 284 to 342 (59 residues), 33.9 bits, see alignment E=3.2e-12

Best Hits

Swiss-Prot: 78% identical to ANSME_BACTN: Anaerobic sulfatase-maturating enzyme (chuR) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K06871, (no description) (inferred from 100% identity to bvu:BVU_0531)

Predicted SEED Role

"Putative arylsulfatase regulatory protein" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9U6U0 at UniProt or InterPro

Protein Sequence (411 amino acids)

>HMPREF1058_RS08540 anaerobic sulfatase-maturation protein (Phocaeicola vulgatus CL09T03C04)
MKEATITPFAKPLYIMTKPVGAVCNLACDYCYYLEKSKLYEEQPRHVMSDELLEKFIKEY
IQSQTMPQVLFTWHGGETLMRPLVFYKKALELQKKYAGGRTIDNCIQTNGTLLTDEWCEF
FRENNFLVGISIDGPQEFHDEYRKNKMGQPSFYKVMKGINLLKKHGVEWNAMAVVNDYNA
DYPLDFYRFFRDELDCHYIQFTPIVERLSSRADGLRLSSLKQKDGELAPFSITPEQWGNF
LCTIFDEWVLNDVGNYYIQLFDSTLANWVGQQPGVCSLAKYCGHAAVMEFNGDVYACDHF
VFPEYKLGNIYQKTLVEMMYGKEQETFGVMKHNSLPQQCLNCSYEFACHGECPKNRFMLS
KDGEPGLNYLCKGYYQFFDHVAPYMDFMKKEYLAERAPANVMEWARERRNK