Protein Info for HMPREF1058_RS08370 in Phocaeicola vulgatus CL09T03C04

Annotation: DUF5110 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 819 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13802: Gal_mutarotas_2" amino acids 39 to 198 (160 residues), 68 bits, see alignment E=2.8e-22 PF01055: Glyco_hydro_31_2nd" amino acids 240 to 595 (356 residues), 296.7 bits, see alignment E=5.3e-92 PF21365: Glyco_hydro_31_3rd" amino acids 606 to 708 (103 residues), 85.7 bits, see alignment E=4.8e-28 PF17137: DUF5110" amino acids 725 to 792 (68 residues), 84.5 bits, see alignment E=8.5e-28

Best Hits

KEGG orthology group: K01811, putative family 31 glucosidase (inferred from 100% identity to bvu:BVU_0491)

Predicted SEED Role

"Alpha-xylosidase (EC 3.2.1.-)" in subsystem Xylose utilization (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I8ZSD0 at UniProt or InterPro

Protein Sequence (819 amino acids)

>HMPREF1058_RS08370 DUF5110 domain-containing protein (Phocaeicola vulgatus CL09T03C04)
MSKKISIILLLLCLGLFSQAQSYQKISQGVKTTVQGMDVEVAFYSPSIVRVYKTPEGSSY
DKKSLVVMKEPEETFVEFAMNKEYIRLKSDVLQVEVNSSTGGINFYDATGRVLLKDKDYG
TQFTPFDDAGTFSYNVRQAFLLDKDEVIYGLGQQQTGKVNQRNQKLFLRNKNMSICIPFI
HSVKGYGLYWDNYSPTMFTDNPQEMSFDSEVGDCADYYFIYGSNADGVIAGVRDLTGQAP
LYPLWTLGFWQCRERYKSPDELCEVVDEYRDRKVPLDGIIQDWQYWGCDSNWNSMKFQNP
RYINKMGDKEYMKYLPNGENPDARYGTPRIKSPQEMIDYIHKRNAHIMISVWASFGPWTE
MYHKMDSLNALLHFETWPPKAGVKPYDPFNPVARSIYWNEMKKNIFDLGMDGWWLDSTEP
DHLEIQDKDFDTKTYLGSFRRVHNAFPLMSNKGVYEHQRATTSDKRVFLLTRSSFLGQQR
YASHSWSGDVVSTWEVMRKQLAAGLNYSLCGIPYWNTDLGGFFAWKYNNDVNNIAYHELH
VRWYQWGAFQPIMRSHNSSPVAVEIYQFGDKGDWAYDALEKYTHLRYRLLPYLYSTTWEV
TNKAGSIIRPLVMDFPKDKKVLDMDTEYMFGRSFLVRPVTDSLYTWQDKKQNGYQKNMRK
IEKTDVYLPEGSNWFDFWTGAKLAGGQTIQREVPIDIMPVYIRAGSIIPWGPAVQYATEK
SWDDLEIRVYPGANATFILYEDENDNYNYEKGVYSTITFRWDDSNRTLHISDREGRYPGM
LEKRKFKVVLVNHRSGEGDKPLKGGKMVNYTGTAIEVKL