Protein Info for HMPREF1058_RS08300 in Phocaeicola vulgatus CL09T03C04

Annotation: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01128: IspD
  • amino acids 4 to 218 (215 residues), 172.1 bits, E=1.6e-54
• TIGR00453: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
  • amino acids 5 to 218 (214 residues), 203.1 bits, E=2e-64
• PF12804: NTP_transf_3
  • amino acids 5 to 132 (128 residues), 48.6 bits, E=1.1e-16

Best Hits

Swiss-Prot: 100% identical to ISPD_BACV8: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (ispD) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K00991, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC: 2.7.7.60] (inferred from 100% identity to bvu:BVU_0472)

Predicted SEED Role

"2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60)" in subsystem Isoprenoid Biosynthesis or Teichoic and lipoteichoic acids biosynthesis or polyprenyl synthesis (EC 2.7.7.60)

MetaCyc Pathways

• methylerythritol phosphate pathway II (8/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (8/12 steps found)
• taxadiene biosynthesis (engineered) (8/13 steps found)
• methylerythritol phosphate pathway I (5/9 steps found)
• isoprene biosynthesis I (5/10 steps found)
• superpathway of ergosterol biosynthesis II (7/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.60

Sequence Analysis Tools

See I9U6X4 at UniProt or InterPro

Protein Sequence (219 amino acids)

>HMPREF1058_RS08300 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (Phocaeicola vulgatus CL09T03C04)
MNRHVIIVAGGKGLRMGGDIPKQFLPVGGKPVLMRTIEAFYAFDSSIHIILVLPVSQQAY
WKDLCETYHFALRHDIADGGETRFHSVKNGLAYVKGEGLVGVHDGVRPFVSREVIAGCYE
AAQTKQAVIPVIDVVETVRHLTKPGSETVPRNDYKLVQTPQVFEVQLLKEAYQQEYTDAF
TDDASVVEAMGREVCLVQGNRENIKLTTPFDLKIAEVLI