Protein Info for HMPREF1058_RS08260 in Phocaeicola vulgatus CL09T03C04

Annotation: GTP cyclohydrolase I FolE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 TIGR00063: GTP cyclohydrolase I" amino acids 18 to 195 (178 residues), 253.7 bits, see alignment E=3.8e-80 PF01227: GTP_cyclohydroI" amino acids 19 to 194 (176 residues), 255.2 bits, see alignment E=1.3e-80

Best Hits

Swiss-Prot: 86% identical to GCH1_BACFN: GTP cyclohydrolase 1 (folE) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: K01495, GTP cyclohydrolase I [EC: 3.5.4.16] (inferred from 100% identity to bvu:BVU_0464)

Predicted SEED Role

"GTP cyclohydrolase I (EC 3.5.4.16) type 1" in subsystem Folate Biosynthesis or Molybdenum cofactor biosynthesis or Pterin biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9IW31 at UniProt or InterPro

Protein Sequence (197 amino acids)

>HMPREF1058_RS08260 GTP cyclohydrolase I FolE (Phocaeicola vulgatus CL09T03C04)
MEELLHPEWSAEKIEQLKGHYQSILSLLGEDVEREGLLKTPERVAKAMLTLTRGYEQDPH
AILLGAKFKEEYSQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDV
FSHRLQVQERMTLQIKECIQETLNPLGVMVVVEAKHMCMQMRGVEKQNAITTTSDFTGAF
NQAKTREEFMNLIRHNR