Protein Info for HMPREF1058_RS07935 in Phocaeicola vulgatus CL09T03C04

Annotation: peptide chain release factor 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 TIGR00503: peptide chain release factor 3" amino acids 3 to 520 (518 residues), 686.1 bits, see alignment E=2.7e-210 PF00009: GTP_EFTU" amino acids 7 to 270 (264 residues), 182.1 bits, see alignment E=1.3e-57 TIGR00231: small GTP-binding protein domain" amino acids 11 to 153 (143 residues), 87.3 bits, see alignment E=9.7e-29 PF01926: MMR_HSR1" amino acids 11 to 138 (128 residues), 34.5 bits, see alignment E=2.9e-12 PF16658: RF3_C" amino acids 380 to 507 (128 residues), 154.4 bits, see alignment E=2.2e-49

Best Hits

Swiss-Prot: 55% identical to RF3_PELCD: Peptide chain release factor 3 (prfC) from Pelobacter carbinolicus (strain DSM 2380 / NBRC 103641 / GraBd1)

KEGG orthology group: K02837, peptide chain release factor 3 (inferred from 100% identity to bvu:BVU_0074)

Predicted SEED Role

"Peptide chain release factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9U629 at UniProt or InterPro

Protein Sequence (522 amino acids)

>HMPREF1058_RS07935 peptide chain release factor 3 (Phocaeicola vulgatus CL09T03C04)
MNSEIERRRTFAIIAHPDAGKTSLTEKLLLFGGQIQVAGAVKSNKIKKTATSDWMDIEKQ
RGISVTTSVMEFDYNDYKINILDTPGHQDFAEDTYRTLTAVDSVIIVVDGAKGVETQTRK
LMEVCRMRNTPVIIFVNKMDREAKDPFDLLDELEEELIINVRPLTWPIESGPRFKGVYNL
YEHKLNLFQPSKQVVTEKVEVDINTEELDNQIGAPLAEKLRGELELVDGVYPEFNVEEYL
KGEMAPVFFGSALNNFGVQELLDTFVEIAPSPRPTKTEEREVEPDEPKFTGFVFKITANI
DPNHRSCIAFCKICSGKFSRNTPYYHVRHDKTMRFSSPTQFMAQRKTTVDEAWAGDIIGL
PDNGTFKIGDTLTEGEKLHFRGIPSFSPEMFKYIENADPMKQKQLAKGIDQLMDEGVAQL
FINQFNGRKIIGTVGQLQFEVIQYRLENEYNAKCRWEPISLYKACWVESDDPEELEAFKK
RKYQYMAKDREGRDVFLADSNYVLQMAQMDFKHIKFHFTSEF