Protein Info for HMPREF1058_RS07640 in Phocaeicola vulgatus CL09T03C04

Annotation: 30S ribosomal protein S18

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 89 TIGR00165: ribosomal protein bS18" amino acids 19 to 86 (68 residues), 112.5 bits, see alignment E=4.1e-37 PF01084: Ribosomal_S18" amino acids 31 to 81 (51 residues), 92.3 bits, see alignment E=8.2e-31

Best Hits

Swiss-Prot: 100% identical to RS18_BACV8: 30S ribosomal protein S18 (rpsR) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K02963, small subunit ribosomal protein S18 (inferred from 99% identity to bsa:Bacsa_1009)

Predicted SEED Role

"SSU ribosomal protein S18p @ SSU ribosomal protein S18p, zinc-independent"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I8ZQC5 at UniProt or InterPro

Protein Sequence (89 amino acids)

>HMPREF1058_RS07640 30S ribosomal protein S18 (Phocaeicola vulgatus CL09T03C04)
MAQQQSEIRYLTPPSVDVKKKKYCRFKKSGIKYIDYKDPEFLKKFLNEQGKILPRRITGT
SLKFQRRIAQAVKRARHLALLPFVTDMMK