Protein Info for HMPREF1058_RS07580 in Phocaeicola vulgatus CL09T03C04

Annotation: chromosomal replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 PF11638: DnaA_N" amino acids 9 to 68 (60 residues), 55.2 bits, see alignment E=1.4e-18 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 10 to 464 (455 residues), 480.2 bits, see alignment E=3.5e-148 PF00308: Bac_DnaA" amino acids 131 to 345 (215 residues), 264 bits, see alignment E=3.8e-82 PF01695: IstB_IS21" amino acids 167 to 269 (103 residues), 32.3 bits, see alignment E=2.2e-11 PF00910: RNA_helicase" amino acids 168 to 240 (73 residues), 22.7 bits, see alignment E=3.4e-08 PF00004: AAA" amino acids 168 to 269 (102 residues), 26 bits, see alignment E=3.3e-09 PF08299: Bac_DnaA_C" amino acids 376 to 442 (67 residues), 92.1 bits, see alignment E=5.2e-30

Best Hits

Swiss-Prot: 75% identical to DNAA_BACFN: Chromosomal replication initiator protein DnaA (dnaA) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 100% identity to bvu:BVU_0001)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I8ZRS6 at UniProt or InterPro

Protein Sequence (468 amino acids)

>HMPREF1058_RS07580 chromosomal replication initiator protein DnaA (Phocaeicola vulgatus CL09T03C04)
MIENDHVVLWGRCLNLIRDNVPETTFKTWFEPIVPLKYEDKALTIGVPSPFFYEFLEEKF
VDLLRAALYKEIGEGTQLMYCILTDKTNHITVNMEGSKRSSALPTQTVIRDGNKAPNPMQ
APAPQDLDPHLNPNYNFENFIKGNSNEFSRTVGETVAKNPAKTFNPLFLYGPSGVGKTHL
TNAIGTRIKELYPEKRVLYVSAHLFQVQYTDSVRTNHFNDFISFYQTIDVLIIDDIQEFA
GVTKTQNTFFHIFNHLHQNGKQLILTSDRAPVMLQGMEERLLTRFKWGLVAELEKPDVEL
RKNILRNKIRRDGLNIPETVINYIAENVNESVRELEGIINSLLAQSIIFKRDVDLDLAER
IVRKAVRCCESKPVTVEDIIQKVCSHYEIEESAIHTKTRKREVVQVRQVAMYLAKKHTDS
SSSKIGKLIGNKDHATVLHACKIVKDQVEVDKAFKADIEEIEASLKRK