Protein Info for HMPREF1058_RS07560 in Phocaeicola vulgatus CL09T03C04

Annotation: pyridoxal phosphate-dependent aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 45% identical to CBL_BACSU: Cystathionine beta-lyase PatB (patB) from Bacillus subtilis (strain 168)

KEGG orthology group: K14155, cystathione beta-lyase [EC: 4.4.1.8] (inferred from 100% identity to bvu:BVU_4180)

MetaCyc: 38% identical to cysteine-S-conjugate beta-lyase (Streptococcus anginosus)
Cysteine-S-conjugate beta-lyase. [EC: 4.4.1.13]

Predicted SEED Role

"Aspartate aminotransferase (EC 2.6.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.6.1.1)

MetaCyc Pathways

superpathway of aromatic amino acid biosynthesis (18/18 steps found)
superpathway of L-phenylalanine biosynthesis (10/10 steps found)
superpathway of L-tyrosine biosynthesis (10/10 steps found)
superpathway of L-isoleucine biosynthesis I (12/13 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
superpathway of L-aspartate and L-asparagine biosynthesis (4/4 steps found)
aspartate superpathway (19/25 steps found)
L-phenylalanine biosynthesis I (3/3 steps found)
L-serine degradation (3/3 steps found)
L-tyrosine biosynthesis I (3/3 steps found)
superpathway of L-threonine biosynthesis (5/6 steps found)
L-glutamate degradation II (2/2 steps found)
malate/L-aspartate shuttle pathway (2/2 steps found)
superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
3-(4-hydroxyphenyl)pyruvate biosynthesis (1/1 steps found)
L-aspartate biosynthesis (1/1 steps found)
L-aspartate degradation I (1/1 steps found)
superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)
D-serine degradation (2/3 steps found)
L-asparagine degradation III (mammalian) (2/3 steps found)
L-cysteine degradation II (2/3 steps found)
L-tryptophan degradation II (via pyruvate) (2/3 steps found)
TCA cycle VIII (Chlamydia) (4/6 steps found)
L-tryptophan degradation IV (via indole-3-lactate) (1/2 steps found)
L-tyrosine degradation II (1/2 steps found)
atromentin biosynthesis (1/2 steps found)
trans-4-hydroxy-L-proline degradation I (3/5 steps found)
L-methionine biosynthesis I (3/5 steps found)
superpathway of L-methionine biosynthesis (by sulfhydrylation) (8/12 steps found)
L-phenylalanine degradation III (2/4 steps found)
L-tyrosine degradation III (2/4 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (12/18 steps found)
anaerobic energy metabolism (invertebrates, cytosol) (4/7 steps found)
glycine betaine degradation III (4/7 steps found)
(R)-cysteate degradation (1/3 steps found)
L-phenylalanine degradation II (anaerobic) (1/3 steps found)
L-tyrosine degradation IV (to 4-methylphenol) (1/3 steps found)
indole-3-acetate biosynthesis VI (bacteria) (1/3 steps found)
sulfolactate degradation III (1/3 steps found)
L-methionine biosynthesis II (3/6 steps found)
felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
seleno-amino acid biosynthesis (plants) (2/5 steps found)
L-mimosine degradation (4/8 steps found)
glycine betaine degradation I (4/8 steps found)
L-tryptophan degradation VIII (to tryptophol) (1/4 steps found)
homocysteine and cysteine interconversion (1/4 steps found)
superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
superpathway of L-cysteine biosynthesis (fungi) (2/6 steps found)
superpathway of sulfolactate degradation (2/6 steps found)
4-hydroxybenzoate biosynthesis I (eukaryotes) (1/5 steps found)
L-phenylalanine degradation VI (reductive Stickland reaction) (1/5 steps found)
L-tryptophan degradation XIII (reductive Stickland reaction) (1/5 steps found)
L-tyrosine degradation I (1/5 steps found)
L-tyrosine degradation V (reductive Stickland reaction) (1/5 steps found)
superpathway of plastoquinol biosynthesis (1/5 steps found)
C4 photosynthetic carbon assimilation cycle, NAD-ME type (5/11 steps found)
C4 photosynthetic carbon assimilation cycle, PEPCK type (7/14 steps found)
superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (4/10 steps found)
coenzyme M biosynthesis II (1/6 steps found)
glutathione-mediated detoxification I (2/8 steps found)
purine nucleobases degradation II (anaerobic) (13/24 steps found)
superpathway of chorismate metabolism (38/59 steps found)
L-phenylalanine degradation IV (mammalian, via side chain) (2/9 steps found)
glutathione-mediated detoxification II (1/9 steps found)
indole-3-acetate biosynthesis II (3/12 steps found)
rosmarinic acid biosynthesis I (1/10 steps found)
(S)-reticuline biosynthesis I (1/11 steps found)
superpathway of seleno-compound metabolism (5/19 steps found)
superpathway of rosmarinic acid biosynthesis (1/14 steps found)
anaerobic aromatic compound degradation (Thauera aromatica) (3/27 steps found)
Methanobacterium thermoautotrophicum biosynthetic metabolism (18/56 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.1, 4.4.1.8

Use Curated BLAST to search for 2.6.1.1 or 4.4.1.13 or 4.4.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9U6D5 at UniProt or InterPro

Protein Sequence (387 amino acids)

>HMPREF1058_RS07560 pyridoxal phosphate-dependent aminotransferase (Phocaeicola vulgatus CL09T03C04)
MKYNFDKQISRRGTDSYKWDSAESENVLPMWVADMDFRTAPAIVDALRRRVEHGIFGYTR
VPDSYYEAVTGWFARRHGWTIDREWIIYTSGVVPAISAVIKALTVPGDKVLVQTPVYNCF
FSSIRNNGCEMVSSPLVFASNTFTIDYEDLERKTADPKVKVMLLCNPHNPAGRVWKREEL
VRIGEICIRHDVTVVSDEIHCELVFPEYRYTPFASISENFRHHSVVCISPSKAFNIAGLQ
IANIICADANRRAKIDRAINDNEVCDVNPFGVIATQVAYNEGEEWLNQLIKYLQANFLYM
QEFCREHLPEFPITVLEGTYLVWMDCHRLGIHSQELEQRLVNEAGLWLNAGTMYGTEGKG
FMRWNIACPRTTLAEGLKRFTGFVRNL