Protein Info for HMPREF1058_RS07540 in Phocaeicola vulgatus CL09T03C04

Annotation: acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 PF14602: Hexapep_2" amino acids 79 to 112 (34 residues), 18.7 bits, see alignment 1.2e-07 amino acids 132 to 167 (36 residues), 44.6 bits, see alignment 9.8e-16 PF00132: Hexapep" amino acids 133 to 167 (35 residues), 41.8 bits, see alignment 5.5e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to bvu:BVU_4176)

Predicted SEED Role

"Maltose O-acetyltransferase (EC 2.3.1.79)" in subsystem Maltose and Maltodextrin Utilization (EC 2.3.1.79)

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.79

Use Curated BLAST to search for 2.3.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I8ZQH1 at UniProt or InterPro

Protein Sequence (191 amino acids)

>HMPREF1058_RS07540 acetyltransferase (Phocaeicola vulgatus CL09T03C04)
MTLDDFLNHIEAGGALNTPEIYRLMDEMSDEARRVTCEINNSYHSQEELRAFMSRLTGKP
VDETFKMFPPFYTDFGKNITIGRRVFINAGCHFQDHGGVTLGDGCLIGHNVVFATLNHGT
APEDRGAMYPAPIRLGKNVWVGSNSTILRGVTVGDNAIIAAGSVVTKDVAANTVVGGVPA
RHIRDIDRNEK