Protein Info for HMPREF1058_RS07380 in Phocaeicola vulgatus CL09T03C04

Annotation: GH92 family glycosyl hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01180: putative alpha-1,2-mannosidase" amino acids 6 to 749 (744 residues), 812.8 bits, see alignment E=1.3e-248 PF17678: Glyco_hydro_92N" amino acids 28 to 281 (254 residues), 195.2 bits, see alignment E=1.6e-61 PF07971: Glyco_hydro_92" amino acids 287 to 743 (457 residues), 543.4 bits, see alignment E=5.6e-167

Best Hits

KEGG orthology group: None (inferred from 100% identity to bvu:BVU_4135)

Predicted SEED Role

"Alpha-1,2-mannosidase" in subsystem Mannose Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9IT63 at UniProt or InterPro

Protein Sequence (750 amino acids)

>HMPREF1058_RS07380 GH92 family glycosyl hydrolase (Phocaeicola vulgatus CL09T03C04)
MKKQILLSAVLACISVFSAAAQKEPVDYVNPFVGTTNYGTTNPGALTPHGMMSVTPFNVM
GVPEGDKDKDKQWWSTPYEFNNKYLTGFAHVNLSGVGCPELGSLLLMPTTGKLDVDYHNY
GSFYQGETANPGYYTNILDKYNVKCELTATPRTSMARFTFPAGQSNILLNLGEGLTNESG
ATVRFVNDREIEGTKLLGTFCYNPQAVFPIYFVMRINKVPAKRGYWKMMRPMGVEAQWDD
TAGKYKLYTAYTKEISGDDIGVWFTYDTTAEEVIEVSMGVSFVSIENARLNLEKEQPFGT
TFDKLRAEARKKWNDDLSRIKVEGGTEEQKGVFYTAMYHTMVHPNILQDVSGQYPQMEGD
KILTTNRNRYTVFSLWDTYRNYHQLMTLVYPERQMDMIHTMMGMYKEHGWFPKWELYGRE
TLTMEGDPSIPVLVDSWMKGLQDFDIDEAYKGMYKSATTPGKDNLMRPDNDDYMSKGYVP
MESQYDNSVSHALEYYVADYALSTLAEALGKKEDAKLFRKRSMGYKNYYSKDFGTLRPIT
KEGKFYEPFDPKEGANFAPSPGFHEGNAWNYTFFVPHDINGLVKLMGGDKKFVDKLQSVF
DEGNYDPANEPDIAYPYLFSRFKGEEWRTQKLVKELLAKYFTTKPDGIPGNDDTGTMSAW
AIFSMMGFYPDCPGVPEYTLTTPTFDKVTVQLDPKYWGKKELVIKKEGQGDYIKEIRLGN
KKINKYLISHDDLIKAGEITFIVTENPNKK