Protein Info for HMPREF1058_RS07350 in Phocaeicola vulgatus CL09T03C04

Annotation: sigma-70 family RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 10 to 153 (144 residues), 84 bits, see alignment E=4.7e-28 PF04542: Sigma70_r2" amino acids 13 to 77 (65 residues), 46.8 bits, see alignment E=2.2e-16 PF08281: Sigma70_r4_2" amino acids 101 to 151 (51 residues), 36 bits, see alignment E=4.4e-13

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 99% identity to bvu:BVU_4129)

Predicted SEED Role

"RNA polymerase ECF-type sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I8ZMX7 at UniProt or InterPro

Protein Sequence (157 amino acids)

>HMPREF1058_RS07350 sigma-70 family RNA polymerase sigma factor (Phocaeicola vulgatus CL09T03C04)
MSIEQEFADKLVQYKHIIYKVCFMYADNKDDVNDLFQESVFNIWKSYKNFRGESSFVTWV
YRISLNTCISDFRKKKKHDYVPLEQQVDILEDCEHNELLKEMYSLIKRLNKVDRMFILLW
LDEKSYDEIAEITGTNRNNVAIKLHRIKEKLKNMSNL