Protein Info for HMPREF1058_RS07285 in Phocaeicola vulgatus CL09T03C04

Annotation: ROK family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 PF13412: HTH_24" amino acids 20 to 61 (42 residues), 31 bits, see alignment 1.5e-11 PF00480: ROK" amino acids 96 to 396 (301 residues), 173.5 bits, see alignment E=7.7e-55

Best Hits

KEGG orthology group: None (inferred from 100% identity to bvu:BVU_4116)

Predicted SEED Role

"Mlc, transcriptional repressor of MalT (the transcriptional activator of maltose regulon) and manXYZ operon" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9U4T1 at UniProt or InterPro

Protein Sequence (401 amino acids)

>HMPREF1058_RS07285 ROK family transcriptional regulator (Phocaeicola vulgatus CL09T03C04)
MGENLLKEIEKGSKMAVMKKKIITHYIYNGSSTITDLAREMDLSVPTVTKFIDEMCEEGY
INDYGKLETSGGRHPSLYGLNADSGYFVGVEVRQFSINLGLINFKGDVVQLKMNVPFKAK
NTPESLDELCKLIKHFLQKVSVEKDKILNINVNLSGRVNPDLGYSYSIFNFDERPLTDVI
SEKVGGYRVSIDNDTRAMIYGEYMQGVVKGEKNIIFINVSWGLGMGIIIDGKIYKGKSGF
SGEFGHNFGYENEIICHCGKKGCIETEVSGAALHRILLEHINNGENSIISNTKKNLEDLT
LDDIIDAVNKEDLLCIELVEEIGVKLGRHVAGLINIFNPELVIIGGALSRTGDYLTQPIT
TAIRKYTLNLMNRDSVIVESKLKERAGIIGACMLSRSKLFE