Protein Info for HMPREF1058_RS07280 in Phocaeicola vulgatus CL09T03C04

Annotation: HAD family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 PF00702: Hydrolase" amino acids 21 to 199 (179 residues), 74.6 bits, see alignment E=2.2e-24 PF13419: HAD_2" amino acids 23 to 205 (183 residues), 85.7 bits, see alignment E=6.6e-28 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 104 to 205 (102 residues), 37.1 bits, see alignment E=1.8e-13 PF13242: Hydrolase_like" amino acids 160 to 209 (50 residues), 22.2 bits, see alignment 1.6e-08

Best Hits

KEGG orthology group: None (inferred from 98% identity to bvu:BVU_4110)

Predicted SEED Role

"Beta-phosphoglucomutase (EC 5.4.2.6)" in subsystem Maltose and Maltodextrin Utilization or N-Acetyl-Galactosamine and Galactosamine Utilization or Trehalose Uptake and Utilization (EC 5.4.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9IT79 at UniProt or InterPro

Protein Sequence (244 amino acids)

>HMPREF1058_RS07280 HAD family hydrolase (Phocaeicola vulgatus CL09T03C04)
MFKEAINNYLHTHGYESIDLKAVLFDMDGVLFDSMPNHAESWHKIMKRFGFGLSREEAYM
HEGRTGASTINIVSRRERGHDATEEEIKAIYQAKTEEFNKCPKAERMPGALEVLTKIKSE
GLTPMVVTGSGQTSLLDRLNHNFPGIFQANLMVTAFDVKYGKPNPEPYLMALKKGGFKPN
EALVIENAPLGVQAGVAAGIFTIAVNTGPLHDNVLLNEGANLLFHSMPDFNENWETLKQT
IKNK