Protein Info for HMPREF1058_RS07235 in Phocaeicola vulgatus CL09T03C04

Annotation: A/G-specific adenine glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 TIGR01084: A/G-specific adenine glycosylase" amino acids 4 to 263 (260 residues), 298.9 bits, see alignment E=2.1e-93 PF00730: HhH-GPD" amino acids 32 to 149 (118 residues), 74 bits, see alignment E=1.2e-24 PF14815: NUDIX_4" amino acids 230 to 344 (115 residues), 50.6 bits, see alignment E=1.6e-17

Best Hits

KEGG orthology group: K03575, A/G-specific adenine glycosylase [EC: 3.2.2.-] (inferred from 100% identity to bvu:BVU_4101)

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9U4T9 at UniProt or InterPro

Protein Sequence (352 amino acids)

>HMPREF1058_RS07235 A/G-specific adenine glycosylase (Phocaeicola vulgatus CL09T03C04)
MENFSRKLIDWYRENGRDLPWRRTKNPYLIWISEIILQQTRVVQGYDYYQRFVARFPDVF
ALAAADEDEVMKYWQGLGYYSRARNLHAAARRMAEAGGFPVTYTGVRALKGVGEYTAAAI
CSFAYGMPYAVVDGNVYRVLSRWLGIDTPIDSAEGKKLFVRVADELLDRERPGLYNQAIM
DFGALQCTPVAPDCLFCPLNDSCVARLKGIAGSLPVKQHKNKVTNRYFNYIYVRMGAYTF
IHKRSGNDIWKNLYEPPLIETDREWTEEELYASPQFRGMLAGGEEPIVRLVRKGVKHVLS
HRVIYANFYEVILPENSASFAKYQRISVEDLHKFAVSRLVNQFFSLILEPNN