Protein Info for HMPREF1058_RS06825 in Phocaeicola vulgatus CL09T03C04
Annotation: ACP S-malonyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00645, [acyl-carrier-protein] S-malonyltransferase [EC: 2.3.1.39] (inferred from 100% identity to bvu:BVU_3989)MetaCyc: 41% identical to malonyl CoA-acyl carrier protein transacylase (Moorena bouillonii)
RXN-23072
Predicted SEED Role
"Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 2.3.1.39)
MetaCyc Pathways
- superpathway of fatty acids biosynthesis (E. coli) (47/53 steps found)
- superpathway of fatty acid biosynthesis II (plant) (37/43 steps found)
- superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
- superpathway of fatty acid biosynthesis initiation (4/5 steps found)
- fatty acid biosynthesis initiation (mitochondria) (3/4 steps found)
- fatty acid biosynthesis initiation (type II) (2/3 steps found)
- fatty acid biosynthesis initiation (plant mitochondria) (1/4 steps found)
- mycobactin biosynthesis (1/11 steps found)
- pederin biosynthesis (2/14 steps found)
- bryostatin biosynthesis (2/19 steps found)
- apratoxin A biosynthesis (1/22 steps found)
- mupirocin biosynthesis (1/26 steps found)
- corallopyronin A biosynthesis (2/30 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.3.1.39
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See I9ITG6 at UniProt or InterPro
Protein Sequence (295 amino acids)
>HMPREF1058_RS06825 ACP S-malonyltransferase (Phocaeicola vulgatus CL09T03C04) MKAFVFPGQGAQFVGMGKDLYENSALAKELFEKANDILGYRITDIMFEGTDEDLRQTKVT QPAVFLHSVISALCMGDDFKPEMTAGHSLGEFSALVAAGALSFEDGLKLVYARAMAMQKA CEAQPSTMAAIIALPDEKVEEICEAISKEGEVVVAANYNCPGQIVISGSIEGINKACEQM KAAGAKRALPLKVGGAFHSPLMNPAKVELEAAINATEIHTPKCPVYQNVDALPHTDPAEI KANLVAQLTASVRWTQTVKNMVADGADDFTECGPGAVLQGLIKKIDGSVNAHGIA