Protein Info for HMPREF1058_RS06825 in Phocaeicola vulgatus CL09T03C04

Annotation: ACP S-malonyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 TIGR00128: malonyl CoA-acyl carrier protein transacylase" amino acids 2 to 286 (285 residues), 344.1 bits, see alignment E=3.7e-107 PF00698: Acyl_transf_1" amino acids 4 to 283 (280 residues), 137.5 bits, see alignment E=3.6e-44

Best Hits

KEGG orthology group: K00645, [acyl-carrier-protein] S-malonyltransferase [EC: 2.3.1.39] (inferred from 100% identity to bvu:BVU_3989)

MetaCyc: 41% identical to malonyl CoA-acyl carrier protein transacylase (Moorena bouillonii)
RXN-23072

Predicted SEED Role

"Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 2.3.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9ITG6 at UniProt or InterPro

Protein Sequence (295 amino acids)

>HMPREF1058_RS06825 ACP S-malonyltransferase (Phocaeicola vulgatus CL09T03C04)
MKAFVFPGQGAQFVGMGKDLYENSALAKELFEKANDILGYRITDIMFEGTDEDLRQTKVT
QPAVFLHSVISALCMGDDFKPEMTAGHSLGEFSALVAAGALSFEDGLKLVYARAMAMQKA
CEAQPSTMAAIIALPDEKVEEICEAISKEGEVVVAANYNCPGQIVISGSIEGINKACEQM
KAAGAKRALPLKVGGAFHSPLMNPAKVELEAAINATEIHTPKCPVYQNVDALPHTDPAEI
KANLVAQLTASVRWTQTVKNMVADGADDFTECGPGAVLQGLIKKIDGSVNAHGIA