Protein Info for HMPREF1058_RS06610 in Phocaeicola vulgatus CL09T03C04

Annotation: GDP-L-fucose synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 PF04321: RmlD_sub_bind" amino acids 6 to 67 (62 residues), 31 bits, see alignment E=2.2e-11 PF01370: Epimerase" amino acids 7 to 196 (190 residues), 172 bits, see alignment E=2.2e-54 amino acids 225 to 272 (48 residues), 27.3 bits, see alignment 3.6e-10 PF16363: GDP_Man_Dehyd" amino acids 39 to 204 (166 residues), 34.8 bits, see alignment E=2e-12

Best Hits

KEGG orthology group: K02377, GDP-L-fucose synthase [EC: 1.1.1.271] (inferred from 99% identity to bvu:BVU_3945)

Predicted SEED Role

"GDP-L-fucose synthetase (EC 1.1.1.271)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 1.1.1.271)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.271

Use Curated BLAST to search for 1.1.1.271

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I8ZPR9 at UniProt or InterPro

Protein Sequence (358 amino acids)

>HMPREF1058_RS06610 GDP-L-fucose synthase (Phocaeicola vulgatus CL09T03C04)
MEKTAKIYVAGHHGLVGSAIWNNLQQKGYTNLVGRSHKELDLLDGQAVKKFFDEEQPQYV
ILAAAHVGGIMANSLYRADFIYQNLQIQQNVIGESFRHDVKKLLFLGSTCIYPRDAVQPM
KEDVLLTSPLEYTNEPYAIAKIAGLKMCESFNLQYGTNYIAVMPTNLYGPNDNFHLENSH
VLPAMIRKIHLGKCLNEGNWDAVRKDMNLRPVEGIDGSHTDEEILSILKKYGITGQEVTL
WGTGKPLREFLWSEEMADASVYIMEHVDFKDTYAAGSKDIRNCHINIGTGKEITIAQLAD
KIVKEVGYQGKLTFDATKPDGTMRKLTDVSKLHRLGWQHKIDIEEGVHRMYQWYLSKG