Protein Info for HMPREF1058_RS06585 in Phocaeicola vulgatus CL09T03C04

Annotation: PstS family phosphate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF12849: PBP_like_2" amino acids 23 to 257 (235 residues), 163.9 bits, see alignment E=1.3e-51 TIGR02136: phosphate binding protein" amino acids 23 to 271 (249 residues), 244.3 bits, see alignment E=8.1e-77 PF13531: SBP_bac_11" amino acids 33 to 268 (236 residues), 45.2 bits, see alignment E=2e-15 PF01547: SBP_bac_1" amino acids 36 to 260 (225 residues), 35.7 bits, see alignment E=2.1e-12 PF12727: PBP_like" amino acids 39 to 193 (155 residues), 42.8 bits, see alignment E=7e-15

Best Hits

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 100% identity to bvu:BVU_3940)

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I8ZPS3 at UniProt or InterPro

Protein Sequence (272 amino acids)

>HMPREF1058_RS06585 PstS family phosphate ABC transporter substrate-binding protein (Phocaeicola vulgatus CL09T03C04)
MNQLKALFLFILLACSLNITAQRIKGSDTVLPVSQETAEIFMKDDSDRRVTVTGGGTGVG
ISALMDNTTDIAMASRPIKFSEKMKLKAAKQEVEEVIIAYDALAVIVNPSNPVSQLTRQQ
LEAIFRGKITNWKQLGGPDMKIIVYSRETSSGTYEFFKESALKNKNYMSSSLSMPATGAV
IQSVSQTKGAIGYVGLAYLSPRVKAIAVSYDDGKHYVLPSLENGKKKLYPVVRPLYYYYN
VANKEKVTPFIDYILSPQGQNIIKNGGYIPVK