Protein Info for HMPREF1058_RS06525 in Phocaeicola vulgatus CL09T03C04

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 41 to 59 (19 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 217 to 242 (26 residues), see Phobius details amino acids 254 to 274 (21 residues), see Phobius details amino acids 345 to 368 (24 residues), see Phobius details amino acids 387 to 416 (30 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I8ZNC0 at UniProt or InterPro

Protein Sequence (425 amino acids)

>HMPREF1058_RS06525 hypothetical protein (Phocaeicola vulgatus CL09T03C04)
MDSTNISYKEKADKRIILVFIIQLIALGGAVDGFMSHSVKMNSWENCILPIALLYYLSFS
NIDLKKIKALYFVLSVITISQIAVIYKYGTGNILIGRYYDVIIAFVLLRSLGIDRFFFYF
ENSVTILVKISLLLWGVCLLFPMLCNILVPLSLPIGFPTCSFTWGFVGLANLDSTEGLVL
RNLGFAWEPGRFSSILVVTLMIHLFRNRFNLFRKNFVPLLLGIISSQATTGYMAFSVCLL
GLLVNSDKKRSSKLVKYSLCGIFCIVLFCSPFMLEKMKQILDPEYFLNSNNIERLERTGE
QYVPQRAEGLLMEFMNVADSPWIGYGDFKGESYISRELFPTIDIALSNGILQIFAMLGIP
IGLLLYWALYKSSTLLASHFKVKGGYLFFLVICAVNVSYNFFVEPFFMVIILYCLFERKD
RLCVN