Protein Info for HMPREF1058_RS06505 in Phocaeicola vulgatus CL09T03C04

Annotation: LicD family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF04991: LicD" amino acids 24 to 251 (228 residues), 150.8 bits, see alignment E=3.4e-48

Best Hits

Predicted SEED Role

"Lipopolysaccharide cholinephosphotransferase LicD1 (EC 2.7.8.-)" in subsystem Phosphorylcholine incorporation in LPS (EC 2.7.8.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I8ZNC6 at UniProt or InterPro

Protein Sequence (275 amino acids)

>HMPREF1058_RS06505 LicD family protein (Phocaeicola vulgatus CL09T03C04)
MIELEFKESQRIALEILKKVACICEEHNFRYVLIWGTLIGAIRHNGFIPWDDDIDIAMPR
PDYDKLLSFFKKHRDELMPLECLTMETRKNYPHMIARISDSRTWIDVVNEKDCGMGVFVD
IYPFDGLGKTYDEAFKTMEYVGPNNSLIFLAARKYYHKGNTKGIIKNLIKFPAFIYTHIV
GQRYFVKKTNKLLKTLNYEKSAYISCAAWLTHPDRVIFKKEQIENRIKWIFEDAEFYIPK
DYDNVLRTTYGDYMQLPPESERVHHHLYKAYRVEK