Protein Info for HMPREF1058_RS06355 in Phocaeicola vulgatus CL09T03C04

Annotation: threonine ammonia-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00291: PALP
  • amino acids 17 to 301 (285 residues), 286.5 bits, E=1.3e-89
• TIGR01127: threonine ammonia-lyase
  • amino acids 32 to 396 (365 residues), 476.5 bits, E=3.1e-147

Best Hits

Swiss-Prot: 46% identical to TSAL_GEOSL: L-threonine ammonia-lyase (tdcB) from Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)

KEGG orthology group: K01754, threonine dehydratase [EC: 4.3.1.19] (inferred from 100% identity to bvu:BVU_3892)

Predicted SEED Role

"Threonine dehydratase (EC 4.3.1.19)" in subsystem Branched-Chain Amino Acid Biosynthesis or Threonine degradation (EC 4.3.1.19)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (12/13 steps found)
• superpathway of L-threonine metabolism (15/18 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-threonine degradation I (6/6 steps found)
• L-threonine degradation V (2/2 steps found)
• L-methionine degradation II (2/3 steps found)
• hypoglycin biosynthesis (3/14 steps found)
• cyclosporin A biosynthesis (2/15 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Valine, leucine and isoleucine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.19

Sequence Analysis Tools

See I9U588 at UniProt or InterPro

Protein Sequence (398 amino acids)

>HMPREF1058_RS06355 threonine ammonia-lyase (Phocaeicola vulgatus CL09T03C04)
MLQLDAIYKAAHVLKEVVRRTDLIYAPQINPESTVYLKPENLQLTGSFKVRGAYYKISQL
SDEEKARGVIACSAGNHAQGVALAATKCGIKSLICLPEGAPISKVEATKHYGAEVCLVPG
VYDDAYQKALQLRDEKGYTFVHPFDDENVIAGQGTIGLELLEEMPDVEVVIVPIGGGGLI
SGVAYALKALKPSVKVYGVQALGAASMANSILHSRIERLHSVSTFADGIAVKEPGTNTFD
LVNQYVDGVVTVTEDEIAAAILALIERQRIVAEGAGAVSVAAAMFNKVPVKGKKTVCLVS
GGNIDVTILSRVISRGMAKSGRTYAVTLDLIDKPGQLLGVSKIVAEQGGNVISVHHERNS
ESADVTGCALRVVMETRNEEHIASIRQKLLDAGYVIMK