Protein Info for HMPREF1058_RS06105 in Phocaeicola vulgatus CL09T03C04

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 118 to 135 (18 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 277 to 299 (23 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 335 to 352 (18 residues), see Phobius details amino acids 366 to 386 (21 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 24 to 381 (358 residues), 153.2 bits, see alignment E=1e-48 PF01061: ABC2_membrane" amino acids 229 to 350 (122 residues), 30.1 bits, see alignment E=3.5e-11

Best Hits

KEGG orthology group: K01992, ABC-2 type transport system permease protein (inferred from 100% identity to bvu:BVU_3574)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9U2F7 at UniProt or InterPro

Protein Sequence (396 amino acids)

>HMPREF1058_RS06105 ABC transporter permease (Phocaeicola vulgatus CL09T03C04)
MTILNNILAVSWHEFRVMCTRYSILLVLSGGIFVYGLLYNYMYAPNVVRDAPVAVVDMSR
TPLSRSYIRLLDATPQARVLTNNADLPAAKELMKYDEVVGIVYIPADFDARVGRGEEAIY
IMYSTTTAFLYFASMQEASAGAMLAVNDDVRPEQVVFLPQDDIQSVVQTRSVDVVGTALY
NYTDGYGTYLIPAVLMVVIFQTLIFVISMLSGKERETGDILMFAGPEGRDLSFLRMASVV
IGKSFTYLVFYALFSVFLLGLLPLVFQLPHLAYPWKIVALMIPYILATSFFGLACSLFFS
DSDAPLLLVAFFSVGLIFLSGVSYPLELMPWYWQWIHYMVPAAPGTLAFVKINSMGASMS
EISQQYIILWIQCAIYFVLACRAYRYNIKKAKCERQ