Protein Info for HMPREF1058_RS06045 in Phocaeicola vulgatus CL09T03C04

Annotation: large-conductance mechanosensitive channel protein MscL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details TIGR00220: large conductance mechanosensitive channel protein" amino acids 6 to 142 (137 residues), 167 bits, see alignment E=1.1e-53 PF01741: MscL" amino acids 6 to 140 (135 residues), 156.6 bits, see alignment E=1.9e-50

Best Hits

Swiss-Prot: 100% identical to MSCL_BACV8: Large-conductance mechanosensitive channel (mscL) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 100% identity to bvu:BVU_3586)

Predicted SEED Role

"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9IRS1 at UniProt or InterPro

Protein Sequence (146 amino acids)

>HMPREF1058_RS06045 large-conductance mechanosensitive channel protein MscL (Phocaeicola vulgatus CL09T03C04)
MGKSSFLQDFKAFAMRGNVIDMAVGVIIGGAFGKIVSSIVADVIMPPIGLLVGGVNFTDL
KLQLKPAEVVDGVEKAAVTLNYGNFLQATFDFIIIAFSIFLFIRLLAKLNRKKEEVPAPA
APPAPSKEEVLLTEIRDLLKEQAGKK