Protein Info for HMPREF1058_RS05990 in Phocaeicola vulgatus CL09T03C04

Annotation: TolC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02321: OEP" amino acids 26 to 223 (198 residues), 84.8 bits, see alignment E=3.6e-28 amino acids 250 to 427 (178 residues), 95.7 bits, see alignment E=1.6e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to bvu:BVU_3599)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9U2H6 at UniProt or InterPro

Protein Sequence (429 amino acids)

>HMPREF1058_RS05990 TolC family protein (Phocaeicola vulgatus CL09T03C04)
MKRINILFIFIFSVPSATFSQQSDLLEKYRSMAVEYNHDLKAADKHISASIELEKAARKD
LRPKLSGDANFQYTGNPIQLTLDLPSMQNPLTFEGKDMKYGASLTLLQPVYTGGRLLETI
RMAKHQHSLAAHQAEYFRSALCYQTDMQYWNTVARAELLQVATDYRNSIASLTKTIRERV
EAGLVDPQDLLMAEVKLNEAEYQLLQAKSSLETGRMALNSLIGTALHEITEVEDTIPSIV
MNEQLWKQDGSNRPELKIAYDQIGIAESSKKLTDSKYKPQLYVGIEGSYSSPGYNFKSDL
DPNYAVYAKLSVPIFEWGKRRNEKRAASFQIGAATDNLHQVSDHVNLEVQTARVSLSQAM
EQVQLTRNSLEKARKNEQMALERYTEGKVSIVEMIEAQNYRQISQTNYVQAKVSAQGHYS
ALLKALNKY