Protein Info for HMPREF1058_RS04180 in Phocaeicola vulgatus CL09T03C04

Annotation: K(+)-transporting ATPase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details TIGR00681: K+-transporting ATPase, C subunit" amino acids 3 to 187 (185 residues), 170.4 bits, see alignment E=2.1e-54 PF02669: KdpC" amino acids 5 to 186 (182 residues), 236.5 bits, see alignment E=9.3e-75

Best Hits

Swiss-Prot: 99% identical to KDPC_BACV8: Potassium-transporting ATPase KdpC subunit (kdpC) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K01548, K+-transporting ATPase ATPase C chain [EC: 3.6.3.12] (inferred from 99% identity to bvu:BVU_3265)

Predicted SEED Role

"Potassium-transporting ATPase C chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9U0N4 at UniProt or InterPro

Protein Sequence (189 amino acids)

>HMPREF1058_RS04180 K(+)-transporting ATPase subunit C (Phocaeicola vulgatus CL09T03C04)
MKNFIKSFRLTLVFCVFFSVCYILVLWIFAQFAGPNSGNAEVVELNGKVVGAANVGQSFT
EDIYFWGRPSCAGEGYDATSSAGSNKGPTNAEYLAEVEARIDTFLKHHPYLSRKEVPAEM
VTASGSGLDPDITPACAYVQVQRVAKARGMSEETVKAIVDKAVEKPFMGIFGTEKVNVLK
LNAALEKAK