Protein Info for HMPREF1058_RS03985 in Phocaeicola vulgatus CL09T03C04

Annotation: NAD-dependent DNA ligase LigA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 665 PF01653: DNA_ligase_aden" amino acids 5 to 313 (309 residues), 382.1 bits, see alignment E=7.5e-118 TIGR00575: DNA ligase, NAD-dependent" amino acids 10 to 660 (651 residues), 808.8 bits, see alignment E=1.8e-247 PF03120: DNA_ligase_OB" amino acids 317 to 390 (74 residues), 108.6 bits, see alignment E=4.1e-35 PF03119: DNA_ligase_ZBD" amino acids 402 to 428 (27 residues), 49.5 bits, see alignment (E = 1.1e-16) PF14520: HHH_5" amino acids 442 to 495 (54 residues), 28.8 bits, see alignment 4.7e-10 amino acids 510 to 557 (48 residues), 26.9 bits, see alignment 1.9e-09 PF12826: HHH_2" amino acids 505 to 568 (64 residues), 91.8 bits, see alignment E=8.4e-30 PF00533: BRCT" amino acids 589 to 664 (76 residues), 60 bits, see alignment E=7.7e-20

Best Hits

Swiss-Prot: 100% identical to DNLJ_BACV8: DNA ligase (ligA) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K01972, DNA ligase (NAD+) [EC: 6.5.1.2] (inferred from 100% identity to bvu:BVU_3306)

Predicted SEED Role

"DNA ligase (EC 6.5.1.2)" in subsystem DNA Repair Base Excision (EC 6.5.1.2)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.5.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9TZ72 at UniProt or InterPro

Protein Sequence (665 amino acids)

>HMPREF1058_RS03985 NAD-dependent DNA ligase LigA (Phocaeicola vulgatus CL09T03C04)
MTEIERIDQLREELHRHNYNYYVLNAPEITDQEFDKLMRELQDLEEKHPEHRDENSPSMR
VGSDINKNFTQVVHKYPMLSLANTYSETEVTEFYDRVKKSLNEDFEICCEMKYDGTSISL
TYENGKLVRAVTRGDGVQGDDVTGNVKTIRSIPLVLHGKGYPETFEIRGEILMPWVVFEE
LNKEREAREEPLFANPRNAASGTLKLQNSAIVASRKLDAYLYYLLGDNLPCDGHYENLKE
AEKWGFKISDLTRKCKTLQEVFDFIKYWDVERKNLPVATDGIVLKVNSLRQQRNLGFTAK
SPRWAIAYKFQAEQALTRLNKVTYQVGRTGAVTPVANLDPIQLSGTVVKRASLHNADIIE
GLDLHIGDMVYVEKGGEIIPKIVGVDKDARIMIGDKVKFITHCPECGSKLVRYEGEAAYY
CTNDAACPPQIKGKIEHFISRRAMNIDGLGPETVDQFYQEGLIRDVADLYTLKTSDIINL
ERMGEKSAENIIKGIEQSKEVPFERVLFALGIRFVGETVAKKVAKSFKSMDALADASLDN
LIHVDEIGEKIAQSILLYFANPKNRDIIERLRVAGVRLEADEEDTSEHTDKLAGKSIVIS
GVFAHHSRDEYKELIEKHGGKNVGSISSKTSFILAGDNMGPSKLEKAQKLGVTIVSEEEF
LQMIE