Protein Info for HMPREF1058_RS03915 in Phocaeicola vulgatus CL09T03C04

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details amino acids 146 to 169 (24 residues), see Phobius details PF19529: DUF6057" amino acids 120 to 260 (141 residues), 35.7 bits, see alignment E=2.6e-13 amino acids 283 to 382 (100 residues), 54.3 bits, see alignment E=5.9e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to bvu:BVU_3321)

Predicted SEED Role

"FIG00404494: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9TZ83 at UniProt or InterPro

Protein Sequence (383 amino acids)

>HMPREF1058_RS03915 hypothetical protein (Phocaeicola vulgatus CL09T03C04)
MSSNNSLSYKRAARILTVACGLLFSIFSIVYLFVLQKDVVGALHYSLSQGKTHYSPLVGA
IIITVVLLVFRWGINGLMGLKGPVRTLSYFPSCLLLGVLTDVDRTIFHGGNIGDKWFWLL
PLLLLIYIGVVYTLRRVFRSWLNQEGSILGLINSNLAILTLLCLMTVGIGNTNVNFHHEL
AVEQAIRNHHYEAARMVGAKSLETTRTLAVLRAYAMSLEGTMGEHLFEYPQYYGAEGLLF
APHSQETLRLNADSLYAYLGARPHVAEKTVDFLARICRDEIGRHTALNYYMSALLLDKKL
DKFVSAVDMYCFEQDTLPRYYREALVLYKRTHPGYGREVKDTLMVRRLDEFLNRQKEFSS
PVEEKNHMRREYGDTYWWYYRYQ