Protein Info for HMPREF1058_RS03820 in Phocaeicola vulgatus CL09T03C04

Annotation: aspartate carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 TIGR00670: aspartate carbamoyltransferase" amino acids 4 to 299 (296 residues), 359.3 bits, see alignment E=7.3e-112 PF02729: OTCace_N" amino acids 4 to 141 (138 residues), 154.9 bits, see alignment E=1.6e-49 PF00185: OTCace" amino acids 149 to 297 (149 residues), 102.8 bits, see alignment E=2e-33

Best Hits

Swiss-Prot: 100% identical to PYRB_BACV8: Aspartate carbamoyltransferase (pyrB) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K00609, aspartate carbamoyltransferase catalytic subunit [EC: 2.1.3.2] (inferred from 100% identity to bvu:BVU_3337)

Predicted SEED Role

"Aspartate carbamoyltransferase (EC 2.1.3.2)" in subsystem De Novo Pyrimidine Synthesis (EC 2.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.3.2

Use Curated BLAST to search for 2.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I8ZIM2 at UniProt or InterPro

Protein Sequence (313 amino acids)

>HMPREF1058_RS03820 aspartate carbamoyltransferase (Phocaeicola vulgatus CL09T03C04)
MENRSLVTIAEHSKEKILYLLEMAKEFEKKPNRKILDGKVVATLFFEPSTRTRLSFETAA
NRLGARVIGFTDPKVTSSSKGETLKDTIMMVSNYADIIVMRHFLEGAARYASEVAPVPIV
NAGDGANQHPSQTMLDLYSIYKTQGTLENLNIYLVGDLKYGRTVHSLLMAMRHFNPTFHF
IAPEELKMPEEYKIYCKEHHIKYKEYTDFNEETIADADILYMTRVQRERFTDLMEYERVK
DVYILRNKMLEHTRPNLRILHPLPRVNEIAYDVDENPKAYYFQQAQNGLYARQAILCDVL
GITLNDVIEDAKK