Protein Info for HMPREF1058_RS03795 in Phocaeicola vulgatus CL09T03C04

Annotation: MATE family efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details amino acids 98 to 122 (25 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 318 to 343 (26 residues), see Phobius details amino acids 363 to 381 (19 residues), see Phobius details amino acids 388 to 409 (22 residues), see Phobius details amino acids 415 to 436 (22 residues), see Phobius details PF01554: MatE" amino acids 22 to 182 (161 residues), 109.3 bits, see alignment E=1.6e-35 amino acids 245 to 403 (159 residues), 70.2 bits, see alignment E=1.8e-23 TIGR00797: MATE efflux family protein" amino acids 22 to 416 (395 residues), 235 bits, see alignment E=6.8e-74 PF14667: Polysacc_synt_C" amino acids 135 to 216 (82 residues), 56.7 bits, see alignment E=3.1e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to bvu:BVU_3342)

Predicted SEED Role

"Na+ driven multidrug efflux pump"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I8ZIM6 at UniProt or InterPro

Protein Sequence (447 amino acids)

>HMPREF1058_RS03795 MATE family efflux transporter (Phocaeicola vulgatus CL09T03C04)
MKGTKNLTQGPILKQLFTLAMPIMATSFIQMAYSLTDMAWVGRIGSEAIAAVGSVGILTW
MSTSISLLNKVGSEVSVGQAIGAQNEQAARAFASHNLTLSLLISLSWGALLFIFATPIIS
IYELEPHIAKMAVEYLRIIATAFPFVFLSAAFTGIFNAAGRSKIPFSINGIGLITNIILD
PIFIFGLSWGTTGAAIATWLAEATVCILFIYQLKQKKILWDDFRLFTKLKKQYTRHILKI
GLPVAALNTLFAFVNMFLGRTATEQGGHLGLMALTTGGQIEAITWNTSQGFSTALSAFVA
QNYAARQISRVLKAYRTTLWMTFIFGSFCTFLFICYGNEIFSIFVPEKAAYETGGVFLRI
DGYSQLFMMLEITIQGVFYGMGRTMPPAVISVTCNYLRIPMALLFVSWGWGLPGIWWSIS
ITSTMKGIICLIWFMLIKKKALNYQAV