Protein Info for HMPREF1058_RS03750 in Phocaeicola vulgatus CL09T03C04

Annotation: CTP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00337: CTP synthase
  • amino acids 4 to 528 (525 residues), 754.2 bits, E=3.6e-231
• PF06418: CTP_synth_N
  • amino acids 5 to 268 (264 residues), 418.1 bits, E=2.2e-129
• PF00117: GATase
  • amino acids 303 to 527 (225 residues), 140.4 bits, E=8.3e-45
• PF07722: Peptidase_C26
  • amino acids 367 to 510 (144 residues), 31.2 bits, E=2.8e-11

Best Hits

Swiss-Prot: 87% identical to PYRG_BACTN: CTP synthase (pyrG) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01937, CTP synthase [EC: 6.3.4.2] (inferred from 100% identity to bvu:BVU_3353)

MetaCyc: 54% identical to CTP synthetase (Bacillus subtilis subtilis 168)
CTP synthase. [EC: 6.3.4.2]

Predicted SEED Role

"CTP synthase (EC 6.3.4.2)" (EC 6.3.4.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (16/18 steps found)
• superpathway of pyrimidine ribonucleosides salvage (9/10 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• UTP and CTP de novo biosynthesis (3/3 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• UTP and CTP dephosphorylation II (1/3 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (1/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (1/4 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.2

Sequence Analysis Tools

See I9TYI1 at UniProt or InterPro

Protein Sequence (532 amino acids)

>HMPREF1058_RS03750 CTP synthase (Phocaeicola vulgatus CL09T03C04)
MGETKYIFVTGGVASSLGKGIISSSIGKLLQARGYNVTIQKFDPYINIDPGTLNPYEHGE
CYVTVDGHEADLDLGHYERFLGIQTTKANNITTGRIYKSVIDKERRGDYLGKTIQVIPHI
TDEIKRNVKLLGSKYKFDFVITEIGGTVGDIESLPYLESIRQLKWEMGRNALCVHLTYVP
YLAAAGELKTKPTQHSVKELQSVGIQPDVLVLRTEHELSTNLKKKVALFCNVDENAVVQS
IDMPTIYEVPLRMQEQGLDVTILQKMGLPVGETPTLGPWRDFLDRRHKATEKVKIGLVGK
YDLQDAYKSILEALSQAATYNDRKADIHFINSEKLTDANVEEQIKDMDGIIICPGFGQRG
IEGKFVAIKYARTHNVPTFGICLGMQCMAIEFARNVLGYTDANSREMDEKTPHNVIDIME
EQKAITNMGGTMRLGAYECILDQHSKTFEAYKSEHIQERHRHRYEFNNDYKQEYEKAGMK
CVGINPESDLVEIIEIPTLKWFIGVQFHPEYSSTVLKPHPLFLSFIKAAIDK