Protein Info for HMPREF1058_RS03490 in Phocaeicola vulgatus CL09T03C04

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF09314: DUF1972
  • amino acids 4 to 171 (168 residues), 47.7 bits, E=4.3e-16
• PF13439: Glyco_transf_4
  • amino acids 15 to 174 (160 residues), 85.1 bits, E=1.8e-27
• PF13579: Glyco_trans_4_4
  • amino acids 16 to 173 (158 residues), 69.7 bits, E=1.2e-22
• PF13477: Glyco_trans_4_2
  • amino acids 19 to 149 (131 residues), 31.6 bits, E=5.3e-11
• PF00534: Glycos_transf_1
  • amino acids 183 to 333 (151 residues), 106.7 bits, E=3.1e-34
• PF13692: Glyco_trans_1_4
  • amino acids 195 to 331 (137 residues), 85.5 bits, E=1.3e-27

Best Hits

KEGG orthology group: None (inferred from 52% identity to dfe:Dfer_0053)

Predicted SEED Role

"Alpha-D-GlcNAc alpha-1,2-L-rhamnosyltransferase (EC 2.4.1.-)" in subsystem Rhamnose containing glycans (EC 2.4.1.-)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

See I8ZIS5 at UniProt or InterPro

Protein Sequence (362 amino acids)

>HMPREF1058_RS03490 glycosyltransferase family 4 protein (Phocaeicola vulgatus CL09T03C04)
MKLVVTGTRGIPDIMGGVETHCEELFPRIADRDVDTTVIRRRSYVRDSLTEWKGVKLVDI
DAPKKKSYEAIVHTFRAINLAKKWKADVVHIHAIGPALLVPYAKMLGMKVVFTHHGPDYD
RDKWGFTAKSVLKLGERLGCRFADDVIVISEVIQDLIARKYHRRERVHLIYNGVPKPEIC
DYPEYFEELGIEKGKYILGMCRFVPEKNLHHLIEAFKKLEAGDCKLVLAGDTDFEDEYSL
GLKKMAQEAGVVLTGFVKGHKLHSLLTNARCYCLPSSHEGLPIALLEAMSYHLPVVVSNI
PANLEVGLSSDCYFHCGDVDALAARLQKVIDEDYHSVQYDMAPYDWDKIAKQVMGVYEGL
LK