Protein Info for HMPREF1058_RS03415 in Phocaeicola vulgatus CL09T03C04

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 PF00534: Glycos_transf_1" amino acids 198 to 349 (152 residues), 67.9 bits, see alignment E=1.2e-22 PF13692: Glyco_trans_1_4" amino acids 204 to 333 (130 residues), 59 bits, see alignment E=9.7e-20 PF20706: GT4-conflict" amino acids 245 to 329 (85 residues), 31.2 bits, see alignment E=1.8e-11

Best Hits

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9IN47 at UniProt or InterPro

Protein Sequence (375 amino acids)

>HMPREF1058_RS03415 glycosyltransferase family 4 protein (Phocaeicola vulgatus CL09T03C04)
MKKKILIKASGITAPSWRGYNAGVGRSTLMLLKSLAKISNLPFDIEIYASGLSSVGFDFH
NLPFKHFSFPIPEKIGCELTRIEPFIRSKFVNYDLLHIPHNLDEVHSKESYIVTLHDVIA
YDRAIANNDIKTAKKWQKMASRAKAIMTCSQYSKSEIVSKLNICPEVVSVVYWGASTDKF
YIEDKNITKRNLHLLGIDGPYFVSISCAHPRKNIRILLKAFQLFLQTNPKHKLVLVWSNP
PQDILQTYAKEISDLKIVFLKYVSDEYLRSLYNGATLTMYPSRSEGFGFPILESFACGTP
VMTCRNSCLQEIGRDVALYVGEDNVDEMVDVMKYFEKNLFNMELFKKMSNNLLPSFSWDE
TASKYVDFYTKSLLL