Protein Info for HMPREF1058_RS03120 in Phocaeicola vulgatus CL09T03C04

Annotation: GTPase Era

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 TIGR00436: GTP-binding protein Era" amino acids 5 to 273 (269 residues), 261.8 bits, see alignment E=6.7e-82 TIGR00231: small GTP-binding protein domain" amino acids 5 to 163 (159 residues), 85.6 bits, see alignment E=3.2e-28 PF02421: FeoB_N" amino acids 7 to 163 (157 residues), 55.9 bits, see alignment E=1.5e-18 PF01926: MMR_HSR1" amino acids 7 to 120 (114 residues), 81.7 bits, see alignment E=1.8e-26 PF10662: PduV-EutP" amino acids 9 to 164 (156 residues), 33.3 bits, see alignment E=1.6e-11 PF00071: Ras" amino acids 9 to 164 (156 residues), 25.2 bits, see alignment E=4.5e-09 PF00009: GTP_EFTU" amino acids 24 to 168 (145 residues), 38.7 bits, see alignment E=3.2e-13 PF07650: KH_2" amino acids 203 to 279 (77 residues), 77.5 bits, see alignment E=2.2e-25

Best Hits

Swiss-Prot: 55% identical to ERA_AMOA5: GTPase Era (era) from Amoebophilus asiaticus (strain 5a2)

KEGG orthology group: K03595, GTP-binding protein Era (inferred from 100% identity to bvu:BVU_0451)

Predicted SEED Role

"GTP-binding protein Era" in subsystem Bacterial Cell Division or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I8ZFX6 at UniProt or InterPro

Protein Sequence (293 amino acids)

>HMPREF1058_RS03120 GTPase Era (Phocaeicola vulgatus CL09T03C04)
MHKAGFVNIVGNPNVGKSTLMNLLVGERISIATFKSQTTRHRIMGILNTDDMQIVFSDTP
GVVKPNYKLQESMLNFSESALVDADILLYVTDVVEKTDKNADFIEKVRNVKVPVLLLINK
IDLTNQEDLVKLVEAWHEQLPQAEIIPISATSKFNVDTVMKRIKELLPDSPPYFGKDQWT
DKPARFFVTEIIREKILLYYDKEIPYSVEVVVEQFKEDAKSIHINAVIYVERESQKGIII
GKQGRALKKVATEARKTLEHFFQKSIYLETFVKVDKDWRSSDKELKNFGYQMD