Protein Info for HMPREF1058_RS03095 in Phocaeicola vulgatus CL09T03C04

Annotation: RNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 81 PF00076: RRM_1" amino acids 4 to 72 (69 residues), 80.9 bits, see alignment E=2.5e-27

Best Hits

Swiss-Prot: 53% identical to RBPD_NOSS1: Putative RNA-binding protein RbpD (rbpD) from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

KEGG orthology group: None (inferred from 100% identity to bvu:BVU_0446)

Predicted SEED Role

"RNA binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I8ZFX9 at UniProt or InterPro

Protein Sequence (81 amino acids)

>HMPREF1058_RS03095 RNA-binding protein (Phocaeicola vulgatus CL09T03C04)
MNMYVGNLNYRVKEGDLEQAMAAYGVVTSVKVIKDRETGKSKGFAFVEMENDAEAAQAMN
ELNGSEFMGRQLVIKEARPRD